PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462945801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bZIP
Protein Properties Length: 565aa    MW: 60270.4 Da    PI: 7.8715
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462945801genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.71.4e-14109171163
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                e e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  462945801 109 EDEAKRRARLVRNRESAHLSRQRKKQYVEELEGKVKAMQATIADLSARISCVTAENAALKQQL 171
                5789********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001705.5E-13109171IPR004827Basic-leucine zipper domain
SMARTSM003387.1E-14109173IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151111171IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-13113171No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-16113171No hitNo description
CDDcd147043.09E-21114165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MAEPSLLAPV AQDPFADLPF PDFQAPPVDD NFAFEDFDLD DLDLDVDFDL DLFAPDGQLS  60
SPPPPLTTSS SSAASPERGS PPSRARGGGS SRSATGKDSR STEKGDGPED EAKRRARLVR  120
NRESAHLSRQ RKKQYVEELE GKVKAMQATI ADLSARISCV TAENAALKQQ LGGAAGGAPP  180
PMPMYPAVYP LPLPMPWVHP AYAMRGSQVP LVPIPKLKPQ QPAPAAAEPP AKKARKTKKV  240
ASVSLLGLLC LFMLCGCLIP AVNRMSGAVD AGEGAAFGPS HRGRVLAVEG PRNIVGEGID  300
PKPPQNASET LPALLYLPRN GKHVKINGNL VIKSIVASEK ASSHVSSYDG KILGSQGKEE  360
TSLAIPGYVA PLKAGEVMES TIELKNKLMA LAPGDGKIYR DDDGLLPQWF SEAMSGPMLS  420
SGMCTEVFQF DVSQSSSHSN GIVPVYSNAM SNSSQNFTEN LPAGRPQKVN RRILYNEAIP  480
LQGSTSNNTE HLKAHPKNES YARSKPSSSV VVSVLADPRE AGDGNNEGRI SSKSLSRIFV  540
VVLIDSVKYV TYSCVLPFKN HSPHL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2456400.0KF245640.1 Eleusine coracana cultivar MR1 bZIP transcription factor a mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461117.10.0hypothetical protein SORBIDRAFT_02g041070
TrEMBLA0A0K0K9Y80.0A0A0K0K9Y8_ELECO; BZIP transcription factor a
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.16e-50bZIP family protein